Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIAL1 Peptide - middle region

TIAL1 Peptide - middle region

Product Specifications

Product Name Alternative

TCBP, TIAR

UniProt

P31483

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001029097.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGGY polyclonal antibody
orb648084-01 50 μL

FGGY polyclonal antibody

Sign In for Pricing
View Details
FGGY polyclonal antibody
orb648084-02 100 µL

FGGY polyclonal antibody

Sign In for Pricing
View Details
FGGY polyclonal antibody
orb648084-03 200 µL

FGGY polyclonal antibody

Sign In for Pricing
View Details
Anti Myzus Persicae Pab
272417 100 µg

Anti Myzus Persicae Pab

Sign In for Pricing
View Details
PSCD2, NT (CYTH2, ARNO, PSCD2, PSCD2L, Cytohesin-2, ARF exchange factor, ARF nucleotide-binding site opener, PH, SEC7 and coiled-coil domain-containing protein 2)
MBS641198-01 0.2 mL

PSCD2, NT (CYTH2, ARNO, PSCD2, PSCD2L, Cytohesin-2, ARF exchange factor, ARF nucleotide-binding site opener, PH, SEC7 and coiled-coil domain-containing protein 2)

Sign In for Pricing
View Details
PSCD2, NT (CYTH2, ARNO, PSCD2, PSCD2L, Cytohesin-2, ARF exchange factor, ARF nucleotide-binding site opener, PH, SEC7 and coiled-coil domain-containing protein 2)
MBS641198-02 5x 0.2 mL

PSCD2, NT (CYTH2, ARNO, PSCD2, PSCD2L, Cytohesin-2, ARF exchange factor, ARF nucleotide-binding site opener, PH, SEC7 and coiled-coil domain-containing protein 2)

Sign In for Pricing
View Details