Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1CC Peptide - N-terminal region

PPP1CC Peptide - N-terminal region

Product Specifications

Product Name Alternative

PP1C, PP-1G, PPP1G

UniProt

P36873

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001231903.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC22A4 Antibody Blocking Peptide
orb1506047 500 µg

SLC22A4 Antibody Blocking Peptide

Sign In for Pricing
View Details
Olig2 Antibody, HRP conjugated
CSB-PA24549B0Rb-01 50 µg

Olig2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Olig2 Antibody, HRP conjugated
CSB-PA24549B0Rb-02 100 µg

Olig2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Anti-mouse Thy1.2 (CD90.2) -InVivo
C00079-01 1 mg

Anti-mouse Thy1.2 (CD90.2) -InVivo

Sign In for Pricing
View Details
Anti-mouse Thy1.2 (CD90.2) -InVivo
C00079-02 5 mg

Anti-mouse Thy1.2 (CD90.2) -InVivo

Sign In for Pricing
View Details
Anti-mouse Thy1.2 (CD90.2) -InVivo
C00079-03 5x 5 mg

Anti-mouse Thy1.2 (CD90.2) -InVivo

Sign In for Pricing
View Details