Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAG Peptide - C-terminal region

YWHAG Peptide - C-terminal region

Product Specifications

Product Name Alternative

PPP1R170, 14-3-3GAMMA

UniProt

P61981

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036611.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TGF beta Receptor II Antibody
RC-15585-01 50 μL

Recombinant TGF beta Receptor II Antibody

Sign In for Pricing
View Details
Recombinant TGF beta Receptor II Antibody
RC-15585-02 100 µL

Recombinant TGF beta Receptor II Antibody

Sign In for Pricing
View Details
Recombinant TGF beta Receptor II Antibody
RC-15585-03 1 mL

Recombinant TGF beta Receptor II Antibody

Sign In for Pricing
View Details
USP6 Human Gene Knockout Kit (CRISPR)
KN215749 1 Kit

USP6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bromelain Crystallized
EC-34424-5g 5 g

Bromelain Crystallized

Sign In for Pricing
View Details
TOFA
SIH-555-50MG 50 mg

TOFA

Sign In for Pricing
View Details