Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAG Peptide - C-terminal region

YWHAG Peptide - C-terminal region

Product Specifications

Product Name Alternative

PPP1R170, 14-3-3GAMMA

UniProt

P61981

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036611.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vertical Autoclave BAVT-304-B
BAVT-304-B 1 Unit

Vertical Autoclave BAVT-304-B

Sign In for Pricing
View Details
c-Myc (MYC) pSer373 Rabbit Polyclonal Antibody
AP01637PU-N 100 µg

c-Myc (MYC) pSer373 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dedicated Platform, 12 x 125ml Erlenmeyer flasks
H1000-P-125 1 Each

Dedicated Platform, 12 x 125ml Erlenmeyer flasks

Sign In for Pricing
View Details
HTRA1 (NM_002775) Human Recombinant Protein
TP322362 20 µg

HTRA1 (NM_002775) Human Recombinant Protein

Sign In for Pricing
View Details
CLEC12A Rabbit Polyclonal Antibody
TA372356 100 µL

CLEC12A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MALT-1 (MT1/410), CF740 conjugate, 0.1mg/mL
BNC740410-100 1x 100 µL

MALT-1 (MT1/410), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details