What is the catalog number for ANXA2 Peptide - middle region?

The catalog number for ANXA2 Peptide - middle region is orb1998981.

What sizes are available for ANXA2 Peptide - middle region?

ANXA2 Peptide - middle region is available in the following size(s): 100 µg.

Is ANXA2 Peptide - middle region in stock?

ANXA2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ANXA2 Peptide - middle region

Product Specifications

Product Name Alternative

P36, ANX2, LIP2, LPC2, CAL1H, LPC2D, ANX2L4, PAP-IV, HEL-S-270

UniProt

P07355

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001002857.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS9401607-01 0.1 mL

ACAD8 antibody

Sign In for Pricing

View Details

MBS9401607-02 5x 0.1 mL

ACAD8 antibody

Sign In for Pricing

View Details

FAB2701A 0.1 mL

Mouse Monoclonal CCL3/CCL4 Antibody (93342) [Allophycocyanin]

Sign In for Pricing

View Details

LBA94877-01 25 mg

Oroxylin A-7-o-glucoside

Sign In for Pricing

View Details

LBA94877-02 50 mg

Oroxylin A-7-o-glucoside

Sign In for Pricing

View Details

LBA94877-03 100 mg

Oroxylin A-7-o-glucoside

Sign In for Pricing

View Details