Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHEK2 Peptide - N-terminal region

CHEK2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDS1, CHK2, LFS2, RAD53, hCds1, HuCds1, PP1425

UniProt

O96017

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001005735.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Phenylbarbituric Acid
TRC-P319743-25MG 25 mg

5-Phenylbarbituric Acid

Sign In for Pricing
View Details
Cofilin 1 (CFL1) Rabbit Polyclonal Antibody
AP02685PU-N 100 µL

Cofilin 1 (CFL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bulk Anti-Human CD16 (3G8) Antibody
ICH1010-100mg 100 mg

Bulk Anti-Human CD16 (3G8) Antibody

Sign In for Pricing
View Details
Human RBM41 activation kit by CRISPRa
GA110673 1 Kit

Human RBM41 activation kit by CRISPRa

Sign In for Pricing
View Details
RPA3 Polyclonal Antibody
E-AB-64914-01 60 µL

RPA3 Polyclonal Antibody

Sign In for Pricing
View Details
RPA3 Polyclonal Antibody
E-AB-64914-02 120 µL

RPA3 Polyclonal Antibody

Sign In for Pricing
View Details