Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHEK2 Peptide - N-terminal region

CHEK2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDS1, CHK2, LFS2, RAD53, hCds1, HuCds1, PP1425

UniProt

O96017

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001005735.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS24 (CHMP3) (NM_016079) Human Recombinant Protein
TP320006M 100 µg

VPS24 (CHMP3) (NM_016079) Human Recombinant Protein

Sign In for Pricing
View Details
SPIRE1 (NM_020148) Human Recombinant Protein
TP313848L 1 mg

SPIRE1 (NM_020148) Human Recombinant Protein

Sign In for Pricing
View Details
ALDH1L1 Human Gene Knockout Kit (CRISPR)
KN413720 1 Kit

ALDH1L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CGK2 (PRKG2) Mouse Monoclonal Antibody [Clone ID: OTI15E6]
CF807769 100 µg

CGK2 (PRKG2) Mouse Monoclonal Antibody [Clone ID: OTI15E6]

Sign In for Pricing
View Details
GOLGA2L1 (C-term) Rabbit Polyclonal Antibody
AP51889PU-N 400 µL

GOLGA2L1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR559095 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details