Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GADD45A Peptide - middle region

GADD45A Peptide - middle region

Product Specifications

Product Name Alternative

DDIT1, GADD45

UniProt

P24522

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186670.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM176B (NM_001101314) Human Over-expression Lysate
LY420315 100 µg

TMEM176B (NM_001101314) Human Over-expression Lysate

Sign In for Pricing
View Details
ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2683), CF594 conjugate, 0.1mg/mL
BNC942683-500 1x 500 µL

ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2683), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC12A6 (NM_001042495) Human Over-expression Lysate
LY420942 100 µg

SLC12A6 (NM_001042495) Human Over-expression Lysate

Sign In for Pricing
View Details
CD30 (TNFRSF8) Mouse Monoclonal Antibody [Clone ID: MEM-268]
AM03094RP-N 100 Tests

CD30 (TNFRSF8) Mouse Monoclonal Antibody [Clone ID: MEM-268]

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS701869 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
FYB Recombinant Rabbit Monoclonal Antibody [JE44-80]
ET7109-38 100 µL

FYB Recombinant Rabbit Monoclonal Antibody [JE44-80]

Sign In for Pricing
View Details