Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GADD45A Peptide - middle region

GADD45A Peptide - middle region

Product Specifications

Product Name Alternative

DDIT1, GADD45

UniProt

P24522

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186670.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDH1 Rabbit Monoclonal Antibody [Clone ID: 24GB1295]
TA424948 100 µL

MDH1 Rabbit Monoclonal Antibody [Clone ID: 24GB1295]

Sign In for Pricing
View Details
TentaGel® S PHB
S30013.100G 100 g

TentaGel® S PHB

Sign In for Pricing
View Details
Rnasek (NM_173742) Mouse Tagged ORF Clone
MG200295 10 µg

Rnasek (NM_173742) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
UBE2E3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B1]
TA504672AM 100 µL

UBE2E3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B1]

Sign In for Pricing
View Details
Recombinant MEIS2 Antibody
RC-15828-01 50 μL

Recombinant MEIS2 Antibody

Sign In for Pricing
View Details
Recombinant MEIS2 Antibody
RC-15828-02 100 µL

Recombinant MEIS2 Antibody

Sign In for Pricing
View Details