What is the catalog number for SACS Peptide - C-terminal region?

The catalog number for SACS Peptide - C-terminal region is orb1998971.

What sizes are available for SACS Peptide - C-terminal region?

SACS Peptide - C-terminal region is available in the following size(s): 100 µg.

Is SACS Peptide - C-terminal region in stock?

SACS Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

SACS Peptide - C-terminal region

Product Specifications

Product Name Alternative

SPAX6, ARSACS, DNAJC29, PPP1R138

UniProt

Q7Z6W7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055178.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPM00122 150 µL - 10 µM

mmu-miR-1892 Primers

Sign In for Pricing

View Details

MBS242515-01 0.05 mg

Goat Polyclonal to Human RGS1

Sign In for Pricing

View Details

MBS242515-02 5x 0.05 mg

Goat Polyclonal to Human RGS1

Sign In for Pricing

View Details

VAng-Yyj1916-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Leprae dut Protein (aa 1-154)

Sign In for Pricing

View Details

NB110-58734APC 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (CB30) [Allophycocyanin]

Sign In for Pricing

View Details

20395ES60 100 U

Recombinant Bovine Enterokinase, His, Expressed in Yeast (5U/μL)

Sign In for Pricing

View Details