Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SACS Peptide - C-terminal region

SACS Peptide - C-terminal region

Product Specifications

Product Name Alternative

SPAX6, ARSACS, DNAJC29, PPP1R138

UniProt

Q7Z6W7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055178.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Mouse ECFR (Eosinophil chemotactic factor receptor)
E-EL-M0463 96 Tests

ELISA kit for Mouse ECFR (Eosinophil chemotactic factor receptor)

Sign In for Pricing
View Details
VIP (NM_003381) Human Tagged ORF Clone Lentiviral Particle
RC203126L1V 200 µL

VIP (NM_003381) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ETV6, NT (ETS-related Protein Tel1, Tel, ETS Translocation Variant 6, Transcription Factor ETV6, TEL, TEL1)
MBS627236-01 0.2 mL

ETV6, NT (ETS-related Protein Tel1, Tel, ETS Translocation Variant 6, Transcription Factor ETV6, TEL, TEL1)

Sign In for Pricing
View Details
ETV6, NT (ETS-related Protein Tel1, Tel, ETS Translocation Variant 6, Transcription Factor ETV6, TEL, TEL1)
MBS627236-02 5x 0.2 mL

ETV6, NT (ETS-related Protein Tel1, Tel, ETS Translocation Variant 6, Transcription Factor ETV6, TEL, TEL1)

Sign In for Pricing
View Details
OR2F2 3'UTR Luciferase Stable Cell Line
TU016372 1.0 mL

OR2F2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HIST1H2BG (N-Term) Rabbit pAb
MBS8551676-01 0.1 mL

HIST1H2BG (N-Term) Rabbit pAb

Sign In for Pricing
View Details