Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SACS Peptide - C-terminal region

SACS Peptide - C-terminal region

Product Specifications

Product Name Alternative

SPAX6, ARSACS, DNAJC29, PPP1R138

UniProt

Q7Z6W7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055178.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBCB antibody
OAGA00140-100UL 100 µL

TBCB antibody

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r148 shRNA (UAS) - Lentiviral mouse Vmn1r148 shRNA (UAS, iRFP) plasmid
GTR15226060 1 Vial

Lentiviral mouse Vmn1r148 shRNA (UAS) - Lentiviral mouse Vmn1r148 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Stat5a, phosphorylated (Tyr694) (Signal Transducer and Activator of Transcription 5A, Mammary Gland Factor, Mgf, Mpf) discontinued
S7972-07U 100 µg

Stat5a, phosphorylated (Tyr694) (Signal Transducer and Activator of Transcription 5A, Mammary Gland Factor, Mgf, Mpf) discontinued

Sign In for Pricing
View Details
Myelin Basic protein (MBP) Human ELISA Kit
F1600 96 Tests

Myelin Basic protein (MBP) Human ELISA Kit

Sign In for Pricing
View Details
Magic™ Membrane Protein Human BACE1 (beta-secretase 1) for Antibody Discovery
MP1007J Each

Magic™ Membrane Protein Human BACE1 (beta-secretase 1) for Antibody Discovery

Sign In for Pricing
View Details
Mouse Activin AB (ACVAB) ELISA Kit
MBS457359 Inquire

Mouse Activin AB (ACVAB) ELISA Kit

Sign In for Pricing
View Details