Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SACS Peptide - C-terminal region

SACS Peptide - C-terminal region

Product Specifications

Product Name Alternative

SPAX6, ARSACS, DNAJC29, PPP1R138

UniProt

Q7Z6W7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055178.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVEQAWKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grx1 shRNA Plasmid (m)
sc-145430-SH 20 µg

Grx1 shRNA Plasmid (m)

Sign In for Pricing
View Details
NGB Protein Lysate (Human) with C-Ha Tag
31796031 100 µg

NGB Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
HECW2 (HECT, C2 and WW Domain Containing E3 Ubiquitin Protein Ligase 2, DKFZp686M17164, NEDL2) (MaxLight 650)
MBS6227939-01 0.1 mL

HECW2 (HECT, C2 and WW Domain Containing E3 Ubiquitin Protein Ligase 2, DKFZp686M17164, NEDL2) (MaxLight 650)

Sign In for Pricing
View Details
HECW2 (HECT, C2 and WW Domain Containing E3 Ubiquitin Protein Ligase 2, DKFZp686M17164, NEDL2) (MaxLight 650)
MBS6227939-02 5x 0.1 mL

HECW2 (HECT, C2 and WW Domain Containing E3 Ubiquitin Protein Ligase 2, DKFZp686M17164, NEDL2) (MaxLight 650)

Sign In for Pricing
View Details
Polyclonal Antibody to Claudin 5 (CLDN5)
TRV-0055331-01 20 µL

Polyclonal Antibody to Claudin 5 (CLDN5)

Sign In for Pricing
View Details
Polyclonal Antibody to Claudin 5 (CLDN5)
TRV-0055331-02 100 µL

Polyclonal Antibody to Claudin 5 (CLDN5)

Sign In for Pricing
View Details