Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NF2 Peptide - middle region

NF2 Peptide - middle region

Product Specifications

Product Name Alternative

ACN, SCH, BANF

UniProt

P35240

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000259.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RABGGTB Protein Lysate
MBS8418234-01 0.02 mg

Human RABGGTB Protein Lysate

Sign In for Pricing
View Details
Human RABGGTB Protein Lysate
MBS8418234-02 5x 0.02 mg

Human RABGGTB Protein Lysate

Sign In for Pricing
View Details
Beclin 1 (BECN1) Antibody (ALP)
abx446535 100 µg

Beclin 1 (BECN1) Antibody (ALP)

Sign In for Pricing
View Details
Anti-GCLC Antibody Picoband® (Biotine Conjugate)
A01722-Biotin 100 µg/Vial

Anti-GCLC Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Hsa-miR-6767-3p miRNA Antagomir
CIJ2198-01 10 nmol

Hsa-miR-6767-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-6767-3p miRNA Antagomir
CIJ2198-02 20 nmol

Hsa-miR-6767-3p miRNA Antagomir

Sign In for Pricing
View Details