RASSF1 Peptide - middle region
RASSF1 Peptide - middle region
Product Specifications
Product Name Alternative
123F2, RDA32, NORE2A, RASSF1A, REH3P21
UniProt
Q9NS23
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001193886.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
316821 1 Pack (1 Marker (s) x 1 Card)
ISO20560PM-220X125-ACETYLEENGAS Pipe Markers for Gases
Sign In for Pricing
View Details 
K1659804 1.0 µg DNA
PLA2G5 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details orb2979858 100 µL
Vimentin Recombinant Rabbit mAb, Cy5.5 conjugated
Sign In for Pricing
View Details