Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKT2 Peptide - middle region

AKT2 Peptide - middle region

Product Specifications

Product Name Alternative

PKBB, PRKBB, HIHGHH, PKBBETA, RAC-BETA

UniProt

P31751

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001617.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), 0.2mg/mL
BNUB2602-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), 0.2mg/mL

Sign In for Pricing
View Details
Nor-Deoxycholic Acid
TRC-N672000-250MG 250 mg

Nor-Deoxycholic Acid

Sign In for Pricing
View Details
CD11a / ITGAL Mouse Monoclonal Antibody [Clone ID: 8-6.2]
CL013F 100 µg

CD11a / ITGAL Mouse Monoclonal Antibody [Clone ID: 8-6.2]

Sign In for Pricing
View Details
Human LAP3 Recombinant Rabbit monoclonal Antibody
HA723284 100 µL

Human LAP3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (NM_000224) Human Recombinant Protein
TP760377 50 µg

Cytokeratin 18 (KRT18) (NM_000224) Human Recombinant Protein

Sign In for Pricing
View Details
Carboxypeptidase A (CPA1) Human Gene Knockout Kit (CRISPR)
KN402720 1 Kit

Carboxypeptidase A (CPA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details