Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKT2 Peptide - middle region

AKT2 Peptide - middle region

Product Specifications

Product Name Alternative

PKBB, PRKBB, HIHGHH, PKBBETA, RAC-BETA

UniProt

P31751

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001617.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PTEN MMAC1 TEP1 Protein (Trx Tag)
PDEH100566-01 20 µg

Recombinant Human PTEN MMAC1 TEP1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human PTEN MMAC1 TEP1 Protein (Trx Tag)
PDEH100566-02 100 µg

Recombinant Human PTEN MMAC1 TEP1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human PTEN MMAC1 TEP1 Protein (Trx Tag)
PDEH100566-03 500 µg

Recombinant Human PTEN MMAC1 TEP1 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human PTEN MMAC1 TEP1 Protein (Trx Tag)
PDEH100566-04 1 mg

Recombinant Human PTEN MMAC1 TEP1 Protein (Trx Tag)

Sign In for Pricing
View Details
Human Intelectin 1 (ITLN1) ELISA Kit
RDR-ITLN1-Hu-01 96 Tests

Human Intelectin 1 (ITLN1) ELISA Kit

Sign In for Pricing
View Details
Human Intelectin 1 (ITLN1) ELISA Kit
RDR-ITLN1-Hu-02 48 Tests

Human Intelectin 1 (ITLN1) ELISA Kit

Sign In for Pricing
View Details