Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRE11 Peptide - middle region

MRE11 Peptide - middle region

Product Specifications

Product Name Alternative

ATLD, HNGS1, MRE11A, MRE11B

UniProt

P49959

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005581.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMED1 Conjugated Antibody
C40154 100 µL

TMED1 Conjugated Antibody

Sign In for Pricing
View Details
Arylsulfatase D Recombinant Protein Antigen
NBP2-56968PEP 100 µL

Arylsulfatase D Recombinant Protein Antigen

Sign In for Pricing
View Details
S1PR3 Antibody, Biotin conjugated
A66417-100UG 100 µg

S1PR3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
FRPD3 rabbit pAb Antibody
orb2305196-01 50 µL

FRPD3 rabbit pAb Antibody

Sign In for Pricing
View Details
FRPD3 rabbit pAb Antibody
orb2305196-02 100 µL

FRPD3 rabbit pAb Antibody

Sign In for Pricing
View Details
Histone H3, Dimethyl (Lys9) (APC) discontinued
H5110-14E-APC 100 µL

Histone H3, Dimethyl (Lys9) (APC) discontinued

Sign In for Pricing
View Details