Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDAC3 Peptide - C-terminal region

HDAC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HD3, RPD3, RPD3-2

UniProt

O15379

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003874.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAG3 Human Gene Knockout Kit (CRISPR)
KN418189 1 Kit

STAG3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CD99L2 Protein (Fc Tag)
PKSH032228-01 10 µg

Recombinant Human CD99L2 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD99L2 Protein (Fc Tag)
PKSH032228-02 50 µg

Recombinant Human CD99L2 Protein (Fc Tag)

Sign In for Pricing
View Details
SynaptoRedTMC2
#70021 1x 5 mg

SynaptoRedTMC2

Sign In for Pricing
View Details
CD117 (KIT/983), 0.2mg/mL
BNUB0983-100 1x 100 µL

CD117 (KIT/983), 0.2mg/mL

Sign In for Pricing
View Details
Hygromycin B
TRC-H997600-1G 1 g

Hygromycin B

Sign In for Pricing
View Details