Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDAC3 Peptide - C-terminal region

HDAC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HD3, RPD3, RPD3-2

UniProt

O15379

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003874.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinquin ethyl ester *UltraPure grade*
21253-AAT 5 mg

Zinquin ethyl ester *UltraPure grade*

Sign In for Pricing
View Details
Biotin Conjugated Marasmium oreades agglutinin Lectin (mushroom) -MOA-
BA-9001-1 1 mg

Biotin Conjugated Marasmium oreades agglutinin Lectin (mushroom) -MOA-

Sign In for Pricing
View Details
CD11a (ITGAL) Mouse Monoclonal Antibody [Clone ID: CRIS-3]
AM50204PU-T 20 µg

CD11a (ITGAL) Mouse Monoclonal Antibody [Clone ID: CRIS-3]

Sign In for Pricing
View Details
Recombinant Human APCS/SAP Protein (His Tag)
PKSH033050-01 10 µg

Recombinant Human APCS/SAP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human APCS/SAP Protein (His Tag)
PKSH033050-02 50 µg

Recombinant Human APCS/SAP Protein (His Tag)

Sign In for Pricing
View Details
(S)-1-tert-Butylamino-2,3-propanediol
TRC-B692155-2.5G 2.5 g

(S)-1-tert-Butylamino-2,3-propanediol

Sign In for Pricing
View Details