Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD1 Peptide - middle region

RAD1 Peptide - middle region

Product Specifications

Product Name Alternative

REC1, HRAD1

UniProt

O60671

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002844.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (Pan Nuclear Marker) (rAE-4), CF405S conjugate, 0.1mg/mL
BNC043518-100 1x 100 µL

Histone H1 (Pan Nuclear Marker) (rAE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Perilipin-1 Antibody
KC-1754-01 50 μL

Perilipin-1 Antibody

Sign In for Pricing
View Details
Perilipin-1 Antibody
KC-1754-02 100 µL

Perilipin-1 Antibody

Sign In for Pricing
View Details
Perilipin-1 Antibody
KC-1754-03 1 mL

Perilipin-1 Antibody

Sign In for Pricing
View Details
Laminin gamma 1 (LAMC1) Rabbit Polyclonal Antibody
AP20488PU-N 100 µg

Laminin gamma 1 (LAMC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zc3h12b Mouse Gene Knockout Kit (CRISPR)
KN519637 1 Kit

Zc3h12b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details