Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POT1 Peptide - middle region

POT1 Peptide - middle region

Product Specifications

Product Name Alternative

CMM10, HPOT1

UniProt

Q9NUX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001036059.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ZSCAN4C shRNA Plasmid
abx982742-01 150 µg

Mouse ZSCAN4C shRNA Plasmid

Sign In for Pricing
View Details
Mouse ZSCAN4C shRNA Plasmid
abx982742-02 300 µg

Mouse ZSCAN4C shRNA Plasmid

Sign In for Pricing
View Details
Connexin 32 Antibody
MBS8580615-01 0.1 mL

Connexin 32 Antibody

Sign In for Pricing
View Details
Connexin 32 Antibody
MBS8580615-02 0.1 mL (AF635)

Connexin 32 Antibody

Sign In for Pricing
View Details
Connexin 32 Antibody
MBS8580615-03 0.1 mL (AF610)

Connexin 32 Antibody

Sign In for Pricing
View Details
Connexin 32 Antibody
MBS8580615-04 0.1 mL (AF405S)

Connexin 32 Antibody

Sign In for Pricing
View Details