Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POT1 Peptide - middle region

POT1 Peptide - middle region

Product Specifications

Product Name Alternative

CMM10, HPOT1

UniProt

Q9NUX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001036059.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila melanogaster Putative gustatory receptor 23a, isoform B (Gr23a), partial
MBS7058688 Inquire

Recombinant Drosophila melanogaster Putative gustatory receptor 23a, isoform B (Gr23a), partial

Sign In for Pricing
View Details
Duck Parkinson Disease 7 Domain-Containing Protein 1 (PDDC1) ELISA Kit
MBS9362479 Inquire

Duck Parkinson Disease 7 Domain-Containing Protein 1 (PDDC1) ELISA Kit

Sign In for Pricing
View Details
GDC-0152
C12380-10mg 10 mg

GDC-0152

Sign In for Pricing
View Details
Anti-nNOS Antibody
CPA1816-01 30 µL

Anti-nNOS Antibody

Sign In for Pricing
View Details
Anti-nNOS Antibody
CPA1816-02 50 μL

Anti-nNOS Antibody

Sign In for Pricing
View Details
Anti-nNOS Antibody
CPA1816-03 100 µL

Anti-nNOS Antibody

Sign In for Pricing
View Details