What is the catalog number for TXN Peptide - middle region?

The catalog number for TXN Peptide - middle region is orb1998948.

What sizes are available for TXN Peptide - middle region?

TXN Peptide - middle region is available in the following size(s): 100 µg.

Is TXN Peptide - middle region in stock?

TXN Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

TXN Peptide - middle region

Product Specifications

Product Name Alternative

TRX, TRDX, TRX1

UniProt

P10599

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001231867.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E51P00717 100 µg

GPA Protein, Mouse, Recombinant (C-His)

Sign In for Pricing

View Details

GTR15182383 1 Vial

Lentiviral mouse Krt17 shRNA (UAS) - Lentiviral mouse Krt17 shRNA (UAS) plasmid

Sign In for Pricing

View Details

20146086 1.0 µg

Fam83f 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing

View Details

143348-01 2 µg

GDNF, Recombinant, Rat (Glial-Derived Neurotrophic Factor, ATF-1) discontinued

Sign In for Pricing

View Details

143348-02 10 µg

GDNF, Recombinant, Rat (Glial-Derived Neurotrophic Factor, ATF-1) discontinued

Sign In for Pricing

View Details

TQA12730-01 50 mg

5-{[ (4-Methylphenyl) methyl]amino}-2,3-dihydro-1H-1,3-benzodiazol-2-one

Sign In for Pricing

View Details