What is the catalog number for TXN Peptide - middle region?

The catalog number for TXN Peptide - middle region is orb1998948.

What sizes are available for TXN Peptide - middle region?

TXN Peptide - middle region is available in the following size(s): 100 µg.

Is TXN Peptide - middle region in stock?

TXN Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

TXN Peptide - middle region

Product Specifications

Product Name Alternative

TRX, TRDX, TRX1

UniProt

P10599

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001231867.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RK11556 96 Tests

Human Niban-like protein 1 (FAM129B) ELISA Kit

Sign In for Pricing

View Details

Path-Ctr17 1 x 10^7 IFU/mL - 200 µL

miniPro-Luc (GFP) Lentivirus

Sign In for Pricing

View Details

MBS1234613-01 0.02 mg (E-Coli)

Recombinant Ralstonia pickettii Protein hfq (hfq)

Sign In for Pricing

View Details

MBS1234613-02 0.1 mg (E-Coli)

Recombinant Ralstonia pickettii Protein hfq (hfq)

Sign In for Pricing

View Details

MBS1234613-03 0.02 mg (Yeast)

Recombinant Ralstonia pickettii Protein hfq (hfq)

Sign In for Pricing

View Details

MBS1234613-04 0.1 mg (Yeast)

Recombinant Ralstonia pickettii Protein hfq (hfq)

Sign In for Pricing

View Details