C1QBP Peptide - middle region
C1QBP Peptide - middle region
Product Specifications
Product Name Alternative
P32, HABP1, gC1qR, GC1QBP, SF2p32, gC1Q-R
UniProt
Q07021
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001203.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1364160-01 0.02 mg (E-Coli)
Recombinant Salmonella paratyphi A Outer-membrane lipoprotein LolB (lolB)
Sign In for Pricing
View Details MBS1364160-02 0.1 mg (E-Coli)
Recombinant Salmonella paratyphi A Outer-membrane lipoprotein LolB (lolB)
Sign In for Pricing
View Details MBS1364160-03 0.02 mg (Yeast)
Recombinant Salmonella paratyphi A Outer-membrane lipoprotein LolB (lolB)
Sign In for Pricing
View Details MBS1364160-04 0.1 mg (Yeast)
Recombinant Salmonella paratyphi A Outer-membrane lipoprotein LolB (lolB)
Sign In for Pricing
View Details MBS1364160-05 0.02 mg (Baculovirus)
Recombinant Salmonella paratyphi A Outer-membrane lipoprotein LolB (lolB)
Sign In for Pricing
View Details MBS1364160-06 0.02 mg (Mammalian-Cell)
Recombinant Salmonella paratyphi A Outer-membrane lipoprotein LolB (lolB)
Sign In for Pricing
View Details