Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA2 Peptide - C-terminal region

RPA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

REPA2, RPA32, RP-A p32, RP-A p34

UniProt

P15927

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRC5 Human Gene Knockout Kit (CRISPR)
KN214810 1 Kit

NLRC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CCNA2 Antibody
KC-904-01 50 μL

CCNA2 Antibody

Sign In for Pricing
View Details
CCNA2 Antibody
KC-904-02 100 µL

CCNA2 Antibody

Sign In for Pricing
View Details
CCNA2 Antibody
KC-904-03 1 mL

CCNA2 Antibody

Sign In for Pricing
View Details
6-Thioinosine Phosphate (~90%)
TRC-T344500-25MG 25 mg

6-Thioinosine Phosphate (~90%)

Sign In for Pricing
View Details
STIL / SIL Recombinant Rabbit Monoclonal Antibody [PSH05-79]
HA722490 100 µL

STIL / SIL Recombinant Rabbit Monoclonal Antibody [PSH05-79]

Sign In for Pricing
View Details