Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA2 Peptide - C-terminal region

RPA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

REPA2, RPA32, RP-A p32, RP-A p34

UniProt

P15927

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC37 Protein
SPR-304B 100 µg

CDC37 Protein

Sign In for Pricing
View Details
GLIPR1 (NM_006851) Human Over-expression Lysate
LY402048 100 µg

GLIPR1 (NM_006851) Human Over-expression Lysate

Sign In for Pricing
View Details
4-((4-(7-Chloroquinolin-4-yl)piperazin-1-yl)sulfonyl)-3-nitroaniline
TRC-C430340-50MG 50 mg

4-((4-(7-Chloroquinolin-4-yl)piperazin-1-yl)sulfonyl)-3-nitroaniline

Sign In for Pricing
View Details
N-Des(D-threo-pentitol),-N-(3-pentyl)-Posaconazole
TRC-A648025-25MG 25 mg

N-Des(D-threo-pentitol),-N-(3-pentyl)-Posaconazole

Sign In for Pricing
View Details
Kappa Light Chain (TB28-2), CF405S conjugate, 0.1mg/mL
BNC040708-500 1x 500 µL

Kappa Light Chain (TB28-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FBXO8 Mouse Monoclonal Antibody [Clone ID: OTI9G5]
CF807550 100 µg

FBXO8 Mouse Monoclonal Antibody [Clone ID: OTI9G5]

Sign In for Pricing
View Details