Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLK Peptide - middle region

NLK Peptide - middle region

Product Specifications

UniProt

Q9UBE8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057315.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P40 (Rabbit PAb), CF488A conjugate, 0.1mg/mL
BNC880375-100 1x 100 µL

P40 (Rabbit PAb), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(-)-Beta-Sesquiphellandrene
TRC-S280655-5MG 5 mg

(-)-Beta-Sesquiphellandrene

Sign In for Pricing
View Details
LDHD Rabbit Polyclonal Antibody
TA369187 100 µL

LDHD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATF3 (NM_001040619) Human Over-expression Lysate
LC421782 20 µg

ATF3 (NM_001040619) Human Over-expression Lysate

Sign In for Pricing
View Details
AAL-993
SIH-424-25MG 25 mg

AAL-993

Sign In for Pricing
View Details
Live-or-DyeTM 700/745 Fixable Viability Staining Kit, Trial Size (50 assays)
#32024-T 1 Kit

Live-or-DyeTM 700/745 Fixable Viability Staining Kit, Trial Size (50 assays)

Sign In for Pricing
View Details