Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLK Peptide - middle region

NLK Peptide - middle region

Product Specifications

UniProt

Q9UBE8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057315.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL11 Antibody (Biotin)
KB-022-01 50 μL

IL11 Antibody (Biotin)

Sign In for Pricing
View Details
IL11 Antibody (Biotin)
KB-022-02 100 µL

IL11 Antibody (Biotin)

Sign In for Pricing
View Details
IL11 Antibody (Biotin)
KB-022-03 1 mL

IL11 Antibody (Biotin)

Sign In for Pricing
View Details
CDK6 Rabbit Polyclonal Antibody
AP08102PU-S 50 µL

CDK6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BEX2 Polyclonal Antibody
E-AB-18889-01 20 µL

BEX2 Polyclonal Antibody

Sign In for Pricing
View Details
BEX2 Polyclonal Antibody
E-AB-18889-02 60 µL

BEX2 Polyclonal Antibody

Sign In for Pricing
View Details