Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM2B Peptide - C-terminal region

RRM2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

P53R2, MTDPS8A, MTDPS8B

UniProt

Q7LG56

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001165948.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF1B (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit B, RNA Polymerase I-specific TBP-associated Factor 63kD, TAFI63, TATA Box-binding Protein-associated Factor 1B, TBP-associated Factor 1B, Transcription Initiation Factor SL1/TIF-IB Subunit B)
134183 50 µg

TAF1B (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit B, RNA Polymerase I-specific TBP-associated Factor 63kD, TAFI63, TATA Box-binding Protein-associated Factor 1B, TBP-associated Factor 1B, Transcription Initiation Factor SL1/TIF-IB Subunit B)

Sign In for Pricing
View Details
LYPD3 Protein, Rat, Recombinant (His)
TMPH-04419-01 5 µg

LYPD3 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details
LYPD3 Protein, Rat, Recombinant (His)
TMPH-04419-02 10 µg

LYPD3 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details
LYPD3 Protein, Rat, Recombinant (His)
TMPH-04419-03 20 µg

LYPD3 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details
LYPD3 Protein, Rat, Recombinant (His)
TMPH-04419-04 50 µg

LYPD3 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details
LYPD3 Protein, Rat, Recombinant (His)
TMPH-04419-05 100 µg

LYPD3 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details