Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM2B Peptide - C-terminal region

RRM2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

P53R2, MTDPS8A, MTDPS8B

UniProt

Q7LG56

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001165948.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEFVADRLLVELGFSKVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADORA3 Antibody
OAAJ05737-100UL 100 µL

ADORA3 Antibody

Sign In for Pricing
View Details
Tucatinib Impurity 16
RM-T435016-01 10 mg

Tucatinib Impurity 16

Sign In for Pricing
View Details
Tucatinib Impurity 16
RM-T435016-02 100 mg

Tucatinib Impurity 16

Sign In for Pricing
View Details
Tucatinib Impurity 16
RM-T435016-03 25 mg

Tucatinib Impurity 16

Sign In for Pricing
View Details
Tucatinib Impurity 16
RM-T435016-04 50 mg

Tucatinib Impurity 16

Sign In for Pricing
View Details
Il6r (NM_017020) Rat Untagged Clone
RN207225 10 µg

Il6r (NM_017020) Rat Untagged Clone

Sign In for Pricing
View Details