Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APPL1 Peptide - middle region

APPL1 Peptide - middle region

Product Specifications

Product Name Alternative

APPL, DIP13alpha

UniProt

Q9UKG1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036228.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRP6 (C1QTNF6) (NM_031910) Human Over-expression Lysate
LY403130 100 µg

CTRP6 (C1QTNF6) (NM_031910) Human Over-expression Lysate

Sign In for Pricing
View Details
1,3-Benzodioxole-5-carbonitrile
TRC-B203450-25G 25 g

1,3-Benzodioxole-5-carbonitrile

Sign In for Pricing
View Details
Tissue Total RNA, Lung: right lower lobe
CR561218 5 µg

Tissue Total RNA, Lung: right lower lobe

Sign In for Pricing
View Details
IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), Biotin conjugate, 0.1mg/mL
BNCB3775-500 1x 500 µL

IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G2]
TA500591AM 100 µL

Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G2]

Sign In for Pricing
View Details
Adiponectin receptor protein 1 Recombinant Rabbit Monoclonal Antibody [SC69-04]
ET1610-86 100 µL

Adiponectin receptor protein 1 Recombinant Rabbit Monoclonal Antibody [SC69-04]

Sign In for Pricing
View Details