Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APPL1 Peptide - middle region

APPL1 Peptide - middle region

Product Specifications

Product Name Alternative

APPL, DIP13alpha

UniProt

Q9UKG1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036228.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGPAT7 (LPCAT4) (NM_153613) Human Recombinant Protein
TP310488L 1 mg

AGPAT7 (LPCAT4) (NM_153613) Human Recombinant Protein

Sign In for Pricing
View Details
2-Nitrophenol-3,4,5,6-d4
TRC-N496906-25MG 25 mg

2-Nitrophenol-3,4,5,6-d4

Sign In for Pricing
View Details
Recombinant GPA33 Monoclonal Antibody
AN300125P-01 20 µL

Recombinant GPA33 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant GPA33 Monoclonal Antibody
AN300125P-02 100 µL

Recombinant GPA33 Monoclonal Antibody

Sign In for Pricing
View Details
TBC1D3 Antibody
8C11330-AAT 50 µg

TBC1D3 Antibody

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (DT101 + BC199), CF405S conjugate, 0.1mg/mL
BNC040737-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (DT101 + BC199), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details