Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGO1 Peptide - C-terminal region

SGO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SGO, CAID, SGOL1, NY-BR-85

UniProt

Q5FBB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001012409.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Carbonic Anhydrase II MAb (Clone 322706)
MAB2184 100 µg

Human Carbonic Anhydrase II MAb (Clone 322706)

Sign In for Pricing
View Details
Lentiviral human ADAMTS1 shRNA (UAS) - Lentiviral human ADAMTS1 shRNA (UAS) plasmid
GTR15290671 1 Vial

Lentiviral human ADAMTS1 shRNA (UAS) - Lentiviral human ADAMTS1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
NPR3 ORF Vector (Human) (pORF)
32099011 1.0 µg DNA

NPR3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Norovirus G2 RT PCR kit
RTq-H638-150R 150T

Norovirus G2 RT PCR kit

Sign In for Pricing
View Details
Usp47 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6528302 1.0 µg DNA

Usp47 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Late expression factor 9 (LEF-9), partial
MBS1010902 Inquire

Recombinant Autographa californica nuclear polyhedrosis virus Late expression factor 9 (LEF-9), partial

Sign In for Pricing
View Details