Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SENP2 Peptide - middle region

SENP2 Peptide - middle region

Product Specifications

Product Name Alternative

AXAM2, SMT3IP2

UniProt

Q9HC62

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067640.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSGSWNNMLKLGNKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS7B Antibody
MBS1495335-01 0.05 mg

DHRS7B Antibody

Sign In for Pricing
View Details
DHRS7B Antibody
MBS1495335-02 0.1 mg

DHRS7B Antibody

Sign In for Pricing
View Details
DHRS7B Antibody
MBS1495335-03 5x 0.1 mg

DHRS7B Antibody

Sign In for Pricing
View Details
NDUFS7 Blocking Peptide (Center)
MBS9229140-01 0.5 mg

NDUFS7 Blocking Peptide (Center)

Sign In for Pricing
View Details
NDUFS7 Blocking Peptide (Center)
MBS9229140-02 5x 0.5 mg

NDUFS7 Blocking Peptide (Center)

Sign In for Pricing
View Details
LYZL1 Antibody (C-term) Blocking Peptide
MBS9223542-01 0.5 mg

LYZL1 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details