What is the catalog number for SENP2 Peptide - middle region?

The catalog number for SENP2 Peptide - middle region is orb1998929.

What sizes are available for SENP2 Peptide - middle region?

SENP2 Peptide - middle region is available in the following size(s): 100 µg.

Is SENP2 Peptide - middle region in stock?

SENP2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SENP2 Peptide - middle region

Product Specifications

Product Name Alternative

AXAM2, SMT3IP2

UniProt

Q9HC62

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067640.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSGSWNNMLKLGNKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF807219 100 µg

Factor XII (F12) Mouse Monoclonal Antibody [Clone ID: OTI1H5]

Sign In for Pricing

View Details

32053121 3x 1.0µg DNA

NPFF CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing

View Details

ER21953 96 Tests

Rat HTT (Huntingtin) ELISA Kit

Sign In for Pricing

View Details

APR33201G-01 50 µL

Mouse Fgfr4 Antibody (Center) [APR33201G]

Sign In for Pricing

View Details

APR33201G-02 100 µL

Mouse Fgfr4 Antibody (Center) [APR33201G]

Sign In for Pricing

View Details

APR33201G-03 200 µL

Mouse Fgfr4 Antibody (Center) [APR33201G]

Sign In for Pricing

View Details