Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARF5 Peptide - middle region

ARF5 Peptide - middle region

Product Specifications

UniProt

P84085

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001653.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd8b1 Protein Lysate (Mouse) with C-HA Tag
15578034 100 µg

Cd8b1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Mouse CD8a/Lyt2 Antibody , APC
E55A08038 50 Tests

Mouse CD8a/Lyt2 Antibody , APC

Sign In for Pricing
View Details
SRSF4 Antibody
orb2674144-01 50 µL

SRSF4 Antibody

Sign In for Pricing
View Details
SRSF4 Antibody
orb2674144-02 100 µL

SRSF4 Antibody

Sign In for Pricing
View Details
SRSF4 Antibody
orb2674144-03 200 µL

SRSF4 Antibody

Sign In for Pricing
View Details
CPSF2 Protein Vector (Human) (pPM-C-His)
PV070728 500 ng

CPSF2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details