Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTHL1 Peptide - middle region

NTHL1 Peptide - middle region

Product Specifications

Product Name Alternative

FAP3, NTH1, OCTS3, hNTH1

UniProt

P78549

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001305122.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c Abl (ABL1) (NM_007313) Human Recombinant Protein
TP761989 50 µg

c Abl (ABL1) (NM_007313) Human Recombinant Protein

Sign In for Pricing
View Details
5HT3A receptor (HTR3A) Human Gene Knockout Kit (CRISPR)
KN401342 1 Kit

5HT3A receptor (HTR3A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MALT1 (MALT-Lymphoma Marker) (MT1/3159R), CF647 conjugate, 0.1mg/mL
BNC473159-100 1x 100 µL

MALT1 (MALT-Lymphoma Marker) (MT1/3159R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ss18l2 (NM_026794) Mouse Tagged ORF Clone
MG200114 10 µg

Ss18l2 (NM_026794) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Ribonuclease A6 (RNASE6) ELISA Kit
RD-RNASE6-Hu-01 96 Tests

Human Ribonuclease A6 (RNASE6) ELISA Kit

Sign In for Pricing
View Details
Human Ribonuclease A6 (RNASE6) ELISA Kit
RD-RNASE6-Hu-02 48 Tests

Human Ribonuclease A6 (RNASE6) ELISA Kit

Sign In for Pricing
View Details