Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFC2 Peptide - middle region

RFC2 Peptide - middle region

Product Specifications

Product Name Alternative

RFC40

UniProt

P35250

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265720.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDAMLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LYVE1 activation kit by CRISPRa
GA107465 1 Kit

Human LYVE1 activation kit by CRISPRa

Sign In for Pricing
View Details
CST3 Antibody
MBS8505982-01 0.1 mL

CST3 Antibody

Sign In for Pricing
View Details
CST3 Antibody
MBS8505982-02 0.1 mL (AF405L)

CST3 Antibody

Sign In for Pricing
View Details
CST3 Antibody
MBS8505982-03 0.1 mL (AF405S)

CST3 Antibody

Sign In for Pricing
View Details
CST3 Antibody
MBS8505982-04 0.1 mL (AF610)

CST3 Antibody

Sign In for Pricing
View Details
CST3 Antibody
MBS8505982-05 0.1 mL (AF635)

CST3 Antibody

Sign In for Pricing
View Details