Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP10 Peptide - middle region

DUSP10 Peptide - middle region

Product Specifications

Product Name Alternative

MKP5, MKP-5

UniProt

Q9Y6W6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009138.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDIK1L Peptide - middle region
orb2013668 100 µg

PDIK1L Peptide - middle region

Sign In for Pricing
View Details
Anti-EGFR Antibody-APC (5D853)
TMAY-00022A-01 25 Tests

Anti-EGFR Antibody-APC (5D853)

Sign In for Pricing
View Details
Anti-EGFR Antibody-APC (5D853)
TMAY-00022A-02 100 Tests

Anti-EGFR Antibody-APC (5D853)

Sign In for Pricing
View Details
Nori® Mouse IgG1 ELISA Kit
GR117248 96 Well

Nori® Mouse IgG1 ELISA Kit

Sign In for Pricing
View Details
RIPPLY1 Rabbit Polyclonal Antibody (HRP)
orb2089865 100 µL

RIPPLY1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Transcription Factor MafA (MAFA) Mouse ELISA Kit
H7317 96 Tests

Transcription Factor MafA (MAFA) Mouse ELISA Kit

Sign In for Pricing
View Details