Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP10 Peptide - middle region

DUSP10 Peptide - middle region

Product Specifications

Product Name Alternative

MKP5, MKP-5

UniProt

Q9Y6W6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009138.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GZMG siRNA (Mouse)
CRM1749-01 15 nmol

GZMG siRNA (Mouse)

Sign In for Pricing
View Details
GZMG siRNA (Mouse)
CRM1749-02 30 nmol

GZMG siRNA (Mouse)

Sign In for Pricing
View Details
Adiponectin Rabbit Polyclonal Antibody
orb705352-01 30 µL

Adiponectin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adiponectin Rabbit Polyclonal Antibody
orb705352-02 50 μL

Adiponectin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adiponectin Rabbit Polyclonal Antibody
orb705352-03 100 µL

Adiponectin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adiponectin Rabbit Polyclonal Antibody
orb705352-04 200 µL

Adiponectin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details