CD1C Peptide - middle region
CD1C Peptide - middle region
Product Specifications
Product Name Alternative
R7, CD1, CD1A, BDCA1
UniProt
P29017
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001756.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3857203 1.0 µg DNA
Stk4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details MBS1040275 Inquire
Recombinant Legionella pneumophila Translation initiation factor IF-2 (infB), partial
Sign In for Pricing
View Details OR1066244-01 250 mg
2- (Chloromethyl) -4- (3-methoxypropoxy) -3-methylpyridine 1-oxide hydrochloride
Sign In for Pricing
View Details