EXO1 Peptide - middle region
EXO1 Peptide - middle region
Product Specifications
Product Name Alternative
HEX1, hExoI
UniProt
Q9UQ84
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003677.4
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ESEYGDQEGKRLVDTDVARNSSDDIPNNHIPGDHIPDKATVFTDEESYSF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS717178-01 0.02 mg (Mammalian-Cell)
Recombinant Human Histone acetyltransferase MYST2
Sign In for Pricing
View Details MBS717178-02 0.1 mg (Mammalian-Cell)
Recombinant Human Histone acetyltransferase MYST2
Sign In for Pricing
View Details MBS717178-03 1 mg (Mammalian-Cell)
Recombinant Human Histone acetyltransferase MYST2
Sign In for Pricing
View Details MBS717178-04 5x 1 mg (Mammalian-Cell)
Recombinant Human Histone acetyltransferase MYST2
Sign In for Pricing
View Details 
BNC741784-100 1x 100 µL
Histone H1 (Nuclear Marker) (HH1/1784R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 