EXO1 Peptide - middle region
EXO1 Peptide - middle region
Product Specifications
Product Name Alternative
HEX1, hExoI
UniProt
Q9UQ84
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003677.4
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ESEYGDQEGKRLVDTDVARNSSDDIPNNHIPGDHIPDKATVFTDEESYSF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
19762116 3x 1.0 µg
Fam131b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details 
bsm-62198R-BF750 100 µL
Thyroid hormone receptor alpha Recombinant Antibody, AbBy Fluor™ 750 Conjugated
Sign In for Pricing
View Details LV749520 1.0 µg DNA
SRGAP3-AS3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details 
MBS6214608-01 0.1 mL
Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (MaxLight 550)
Sign In for Pricing
View Details MBS6214608-02 5x 0.1 mL
Thioredoxin Domain-containing Protein 4 (TXNDC4, Endoplasmic Reticulum Resident Protein 44, ER Protein 44, ERp44, KIAA0573, PDIA10, UNQ532/PRO1075) (MaxLight 550)
Sign In for Pricing
View Details