Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRAS Peptide - C-terminal region

MRAS Peptide - C-terminal region

Product Specifications

Product Name Alternative

M-RAs, RRAS3, R-RAS3

UniProt

O14807

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001078518.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgM Immunoglobulin (IM260), 0.2mg/mL
BNUB0260-100 1x 100 µL

IgM Immunoglobulin (IM260), 0.2mg/mL

Sign In for Pricing
View Details
APEX2 Human Gene Knockout Kit (CRISPR)
KN200320BN 1 Kit

APEX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Nucleolin (NCL) ELISA Kit
RD-NCL-Mu-01 96 Tests

Mouse Nucleolin (NCL) ELISA Kit

Sign In for Pricing
View Details
Mouse Nucleolin (NCL) ELISA Kit
RD-NCL-Mu-02 48 Tests

Mouse Nucleolin (NCL) ELISA Kit

Sign In for Pricing
View Details
Cox16 Mouse Gene Knockout Kit (CRISPR)
KN503715 1 Kit

Cox16 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPL13AP17 (NM_203308) Human Over-expression Lysate
LC404390 20 µg

RPL13AP17 (NM_203308) Human Over-expression Lysate

Sign In for Pricing
View Details