Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHOC2 Peptide - N-terminal region

SHOC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SOC2, SUR8, SIAA0862

UniProt

Q9UQ13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001255968.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFSVDNTIKRPNPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT2 Antibody
KC-920-01 50 μL

STAT2 Antibody

Sign In for Pricing
View Details
STAT2 Antibody
KC-920-02 100 µL

STAT2 Antibody

Sign In for Pricing
View Details
STAT2 Antibody
KC-920-03 1 mL

STAT2 Antibody

Sign In for Pricing
View Details
Human IL-13R alpha 2 Recombinant Rabbit Monoclonal Antibody [PSH07-64] - BSA and Azide free (Detector)
HA722881 100 µL

Human IL-13R alpha 2 Recombinant Rabbit Monoclonal Antibody [PSH07-64] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
4-Chloro-3-sulfamoylbenzoyl Chloride (>90%)
TRC-C428140-5G 5 g

4-Chloro-3-sulfamoylbenzoyl Chloride (>90%)

Sign In for Pricing
View Details
EIF5B Rabbit Polyclonal Antibody
TA361385 100 µL

EIF5B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details