Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHOC2 Peptide - N-terminal region

SHOC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SOC2, SUR8, SIAA0862

UniProt

Q9UQ13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001255968.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFSVDNTIKRPNPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 5-Cyanopicolinate
TRC-E410510-500MG 500 mg

Ethyl 5-Cyanopicolinate

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), Biotin conjugate, 0.1mg/mL
BNCB1143-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (197-2B1), CF405S conjugate, 0.1mg/mL
BNC040931-100 1x 100 µL

CD46 (197-2B1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COMT Antibody
KC-2779-01 50 μL

COMT Antibody

Sign In for Pricing
View Details
COMT Antibody
KC-2779-02 100 µL

COMT Antibody

Sign In for Pricing
View Details
COMT Antibody
KC-2779-03 1 mL

COMT Antibody

Sign In for Pricing
View Details