Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX5B Peptide - middle region

COX5B Peptide - middle region

Product Specifications

Product Name Alternative

COXVB

UniProt

P10606

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001853.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNK6 Antibody
MBS7121294-01 0.05 mg

KCNK6 Antibody

Sign In for Pricing
View Details
KCNK6 Antibody
MBS7121294-02 0.1 mg

KCNK6 Antibody

Sign In for Pricing
View Details
KCNK6 Antibody
MBS7121294-03 5x 0.1 mg

KCNK6 Antibody

Sign In for Pricing
View Details
MES
abx082003 100 g

MES

Sign In for Pricing
View Details
ISO20560PM-180X1700-AMMONIAK Pipe Markers for Acids & Bases
317618 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-180X1700-AMMONIAK Pipe Markers for Acids & Bases

Sign In for Pricing
View Details
Pkig Mouse Gene Knockout Kit (CRISPR)
KN513362 1 Kit

Pkig Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details