Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX5B Peptide - middle region

COX5B Peptide - middle region

Product Specifications

Product Name Alternative

COXVB

UniProt

P10606

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001853.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eif2s2 3'UTR Luciferase Stable Cell Line
TU203877 1.0 mL

Eif2s2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human GPR21 shRNA (UAS) - Lentiviral human GPR21 shRNA (UAS, RFP) plasmid
GTR15333952 1 Vial

Lentiviral human GPR21 shRNA (UAS) - Lentiviral human GPR21 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
ANGPTL4 Protein Vector (Human) (pPB-His-MBP)
PV321754 500 ng

ANGPTL4 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
RHOT1 Antibody - N-terminal region
ARP44817_P050-25UL 25 µL

RHOT1 Antibody - N-terminal region

Sign In for Pricing
View Details
TALDO1 Antibody
MBS9415390-01 0.1 mL

TALDO1 Antibody

Sign In for Pricing
View Details
TALDO1 Antibody
MBS9415390-02 5x 0.1 mL

TALDO1 Antibody

Sign In for Pricing
View Details