Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC123 Peptide - N-terminal region

CDC123 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D123, C10orf7

UniProt

O75794

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006014.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVVSGRDDPPTHSQPDSDDEAEEIQWSDDENTATLTAPEFPEFATKVQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Nuclear Matrix Protein 22 ELISA Kit
MBS7255407-01 48 Well

Rat Nuclear Matrix Protein 22 ELISA Kit

Sign In for Pricing
View Details
Rat Nuclear Matrix Protein 22 ELISA Kit
MBS7255407-02 96 Well

Rat Nuclear Matrix Protein 22 ELISA Kit

Sign In for Pricing
View Details
Rat Nuclear Matrix Protein 22 ELISA Kit
MBS7255407-03 5x 96 Well

Rat Nuclear Matrix Protein 22 ELISA Kit

Sign In for Pricing
View Details
Rat Nuclear Matrix Protein 22 ELISA Kit
MBS7255407-04 10x 96 Well

Rat Nuclear Matrix Protein 22 ELISA Kit

Sign In for Pricing
View Details
CAMK2D Protein Vector (Rat) (pPB-N-His)
PV257307 500 ng

CAMK2D Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Cerberus (CER)
TRV-0015015-01 10 µg

Recombinant Cerberus (CER)

Sign In for Pricing
View Details