CDC123 Peptide - N-terminal region
CDC123 Peptide - N-terminal region
Product Specifications
Product Name Alternative
D123, C10orf7
UniProt
O75794
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_006014.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TLVVSGRDDPPTHSQPDSDDEAEEIQWSDDENTATLTAPEFPEFATKVQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2026327-01 0.1 mL
Polyclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
Sign In for Pricing
View Details MBS2026327-02 0.2 mL
Polyclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
Sign In for Pricing
View Details MBS2026327-03 0.5 mL
Polyclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
Sign In for Pricing
View Details MBS2026327-04 1 mL
Polyclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
Sign In for Pricing
View Details MBS2026327-05 5 mL
Polyclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
Sign In for Pricing
View Details MBS2026327-06 5x 5 mL
Polyclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
Sign In for Pricing
View Details